PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G557300.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 699aa    MW: 78185.3 Da    PI: 6.441
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G557300.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.7e-28379429252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Sevir.9G557300.5.p 379 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 429
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006368449IPR003035RWP-RK domain
PfamPF020423.1E-26381429IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2404.9E-24597681No hitNo description
SuperFamilySSF542778.83E-22598680No hitNo description
SMARTSM006665.4E-22600683IPR000270PB1 domain
PROSITE profilePS5174522.045600683IPR000270PB1 domain
CDDcd064071.10E-40601682No hitNo description
PfamPF005641.2E-15601681IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MPRRRRARHD HAEGQLQCRD REHMQCSQGR DVLLPGTPIP EEVDLRSTDV SSDPHANVSL  60
NVADTSYRAI VPEIIDVLRT VCERHELPLA QTWIPCICQA KRGSRHSDEK FKYCVSTVDE  120
ACYIRDPNVT GFHQACSDHH LFRGEGVVGR AFGTNEPCFA TDVTAYSKAQ YPLSHHAKLF  180
NLKAAVAIRL RSIRTGSLDY VLEFFLPVDC IESEEQRAML NSLSITIQQT CYTLRVVSLK  240
ELVDEGSFET STVTPAEFYE KPIHENLDEV CSNIEVPVRT TSLETSEEVT SWIASLVDAQ  300
SKGVKEMDGD LPFGFSKQED EGFSVTAGWH TPPVLGPKGT IFSGFKHHEE YEVKEPICSR  360
HPSPSNLDKT VEKRRTKMEK TVSLEELRKH FAGSLKEAAK NLGVCPTTLK RICRQHGINR  420
WPSRKIKKVG HSLKKLQMVI DSVHGAEGTV QLSSLYENFT KTTWSERELQ GDGTYPLSEQ  480
KGHLEPSVPD RQCEGRFTSH TSGSNSMSPS CSQSSNSSHG CSSGSKSQQN GSAPQLAVKQ  540
EVFMEENQSS TLLKAASHAE LQMFTEERPV TLPRSESQML LSELKPVENM SGMQKSKPES  600
LKIKAMYGEE RCIFRLQPSW GFEKLKEEIV KRFSIGQEMY VDLKYLDDES EWVLLTCDAD  660
LLECIDVYKS SSAQTVRILV NANVQPVLGP SFGQTGLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698188.10.0PREDICTED: protein NLP1-like isoform X1
RefseqXP_012698189.10.0PREDICTED: protein NLP1-like isoform X1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLK4A5H90.0K4A5H9_SETIT; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-138Nin-like family protein